PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf09975g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 60aa    MW: 6995.11 Da    PI: 10.2914
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf09975g00001.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.21.6e-31959151
                              S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                    SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                              krien++nrqvtf+kRrng+lKKA+ELSvLC+ae+a+i+fs++g++yeys+
  Peinf101Scf09975g00001.1  9 KRIENNTNRQVTFCKRRNGLLKKAYELSVLCEAEIALIVFSTRGRVYEYSN 59
                              79***********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.011160IPR002100Transcription factor, MADS-box
SMARTSM004327.2E-40160IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.4E-29259IPR002100Transcription factor, MADS-box
CDDcd002651.23E-36260No hitNo description
PRINTSPR004041.5E-32323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.4E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-323859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 60 aa     Download sequence    Send to blast
MGRGKIEIKR IENNTNRQVT FCKRRNGLLK KAYELSVLCE AEIALIVFST RGRVYEYSNN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P8e-21160160Myocyte-specific enhancer factor 2B
1tqe_Q8e-21160160Myocyte-specific enhancer factor 2B
1tqe_R8e-21160160Myocyte-specific enhancer factor 2B
1tqe_S8e-21160160Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankX816512e-74X81651.1 P.hybrida mRNA for MADS box containing protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016582207.13e-36PREDICTED: agamous-like MADS-box protein AGL11 isoform X1
SwissprotQ388367e-36AGL11_ARATH; Agamous-like MADS-box protein AGL11
TrEMBLM1A2J93e-36M1A2J9_SOLTU; Uncharacterized protein
TrEMBLQ436163e-36Q43616_PETHY; Floral binding protein number 7
STRINGPGSC0003DMT4000132481e-35(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.23e-37MIKC_MADS family protein